Lineage for d2vcxc1 (2vcx C:76-199)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1998816Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1999457Protein automated matches [226848] (11 species)
    not a true protein
  7. 1999514Species Human (Homo sapiens) [TaxId:9606] [224956] (42 PDB entries)
  8. 1999575Domain d2vcxc1: 2vcx C:76-199 [152942]
    Other proteins in same PDB: d2vcxa2, d2vcxb2, d2vcxc2, d2vcxd2
    automated match to d1pd211
    complexed with d26, gsh, mg

Details for d2vcxc1

PDB Entry: 2vcx (more details), 2.1 Å

PDB Description: complex structure of prostaglandin d2 synthase at 2.1a.
PDB Compounds: (C:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2vcxc1:

Sequence, based on SEQRES records: (download)

>d2vcxc1 a.45.1.1 (C:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Sequence, based on observed residues (ATOM records): (download)

>d2vcxc1 a.45.1.1 (C:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwamfnelltynaphlmqdldtylggrewlign
svtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrpqtkl

SCOPe Domain Coordinates for d2vcxc1:

Click to download the PDB-style file with coordinates for d2vcxc1.
(The format of our PDB-style files is described here.)

Timeline for d2vcxc1: