SCOP 1.75: Domain d2v6na1: 2v6n A:2-301

Lineage for d2v6na1 (2v6n A:2-301)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (3 species)
   contains an extra alpha-helical domain

7. Species SARS coronavirus [TaxId:227859] [89349] (20 PDB entries)

8. Domain d2v6na1: 2v6n A:2-301 [152716]
   automatically matched to d1q2wb_
   complexed with mes, so4, xp1

Details for d2v6na1

PDB Entry: 2v6n, 1.98 Å

PDB Description: crystal structures of the sars-coronavirus main proteinase inactivated by benzotriazole compounds

PDB Compounds: (A:) Replicase polyprotein 1ab

SCOP Domain Sequences for d2v6na1:

Sequence; same for both SEQRES and ATOM records:

>d2v6na1 b.47.1.4 (A:2-301) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
gfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirk
snhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngs
psgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkf
ygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyep
ltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcs

Timeline for d2v6na1:

• d2v6na1 is new in SCOP 1.75
  
• d2v6na1 is called d2v6na_ in SCOPe 2.01
  
• d2v6na1 appears in the current release, SCOPe 2.08, called d2v6na_