Lineage for d2v69h2 (2v69 H:12-149)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1028497Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 1028498Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 1028499Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 1028523Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69730] (11 PDB entries)
  8. 1028599Domain d2v69h2: 2v69 H:12-149 [152683]
    Other proteins in same PDB: d2v69a1, d2v69b1, d2v69c1, d2v69d1, d2v69e1, d2v69f1, d2v69g1, d2v69h1, d2v69i_, d2v69j_, d2v69k_, d2v69l_, d2v69m_, d2v69n_, d2v69o_, d2v69p_
    automatically matched to d1gk8a2
    complexed with cap, edo, mg; mutant

Details for d2v69h2

PDB Entry: 2v69 (more details), 2.8 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large- subunit mutation d473e
PDB Compounds: (H:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2v69h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v69h2 d.58.9.1 (H:12-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvwt
dgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkalr
alrledlrippayvktfv

SCOPe Domain Coordinates for d2v69h2:

Click to download the PDB-style file with coordinates for d2v69h2.
(The format of our PDB-style files is described here.)

Timeline for d2v69h2: