Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69730] (11 PDB entries) |
Domain d2v69h2: 2v69 H:12-149 [152683] Other proteins in same PDB: d2v69a1, d2v69b1, d2v69c1, d2v69d1, d2v69e1, d2v69f1, d2v69g1, d2v69h1, d2v69i_, d2v69j_, d2v69k_, d2v69l_, d2v69m_, d2v69n_, d2v69o_, d2v69p_ automatically matched to d1gk8a2 complexed with cap, edo, mg; mutant |
PDB Entry: 2v69 (more details), 2.8 Å
SCOPe Domain Sequences for d2v69h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v69h2 d.58.9.1 (H:12-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} gfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvwt dgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkalr alrledlrippayvktfv
Timeline for d2v69h2: