Lineage for d1c7ca1 (1c7c A:1-142)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 902058Protein Hemoglobin, alpha-chain [46486] (22 species)
  7. 902171Species Human (Homo sapiens) [TaxId:9606] [46487] (200 PDB entries)
    Uniprot P69905 P01922 P01934 P01935
  8. 902240Domain d1c7ca1: 1c7c A:1-142 [15261]
    Other proteins in same PDB: d1c7cb_, d1c7cd_
    recombinant hemoglobin rhb1.1
    complexed with hem

Details for d1c7ca1

PDB Entry: 1c7c (more details), 1.8 Å

PDB Description: deoxy rhb1.1 (recombinant hemoglobin)
PDB Compounds: (A:) protein (deoxyhemoglobin (alpha chain))

SCOPe Domain Sequences for d1c7ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ca1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyrg

SCOPe Domain Coordinates for d1c7ca1:

Click to download the PDB-style file with coordinates for d1c7ca1.
(The format of our PDB-style files is described here.)

Timeline for d1c7ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c7ca2