Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) many known members contain KOW motif |
Family b.34.5.6: Ribosomal protein L19 [141245] (1 protein) Pfam PF01245 |
Protein Ribosomal protein L19 [141246] (3 species) |
Species Thermus thermophilus [TaxId:274] [159030] (4 PDB entries) Uniprot P60490 1-138 |
Domain d2v47t1: 2v47 T:1-138 [152516] Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47n1, d2v47p1, d2v47u1, d2v47v1, d2v47y1, d2v47z1 automatically matched to 2J01 T:1-138 |
PDB Entry: 2v47 (more details), 3.8 Å
SCOPe Domain Sequences for d2v47t1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v47t1 b.34.5.6 (T:1-138) Ribosomal protein L19 {Thermus thermophilus [TaxId: 274]} mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr idqdraaeraakeeaqka
Timeline for d2v47t1: