Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) automatically mapped to Pfam PF00347 |
Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
Protein Ribosomal protein L6 [56055] (6 species) duplication: consists of two domains of this fold |
Species Thermus thermophilus [TaxId:274] [160797] (15 PDB entries) Uniprot Q72I19 11-81! Uniprot Q72I19 82-170 |
Domain d2v47h2: 2v47 H:83-171 [152513] Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47n1, d2v47p1, d2v47t1, d2v47u1, d2v47v1, d2v47y1, d2v47z1 automatically matched to 2J01 H:83-171 |
PDB Entry: 2v47 (more details), 3.8 Å
SCOPe Domain Sequences for d2v47h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v47h2 d.141.1.1 (H:83-171) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]} yskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrvrvsgidkqkvg qvaanirairkpsayhekgiyyagepvrl
Timeline for d2v47h2: