Lineage for d2v46j1 (2v46 J:3-100)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029014Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 1029015Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 1029016Protein Ribosomal protein S10 [55001] (2 species)
  7. 1029042Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
    Uniprot P80375
  8. 1029073Domain d2v46j1: 2v46 J:3-100 [152492]
    Other proteins in same PDB: d2v46b1, d2v46d1, d2v46e1, d2v46f1, d2v46g1, d2v46h1, d2v46i1, d2v46k1, d2v46l1, d2v46m1, d2v46n1, d2v46o1, d2v46p1, d2v46q1, d2v46r1, d2v46s1, d2v46t1, d2v46u1, d2v46y1
    automatically matched to d1fjgj_
    complexed with mg, zn

Details for d2v46j1

PDB Entry: 2v46 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 1 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 1.
PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d2v46j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v46j1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOPe Domain Coordinates for d2v46j1:

Click to download the PDB-style file with coordinates for d2v46j1.
(The format of our PDB-style files is described here.)

Timeline for d2v46j1: