Lineage for d2uxde1 (2uxd E:5-154)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897616Family i.1.1.3: Small subunit [58132] (1 protein)
  6. 897617Protein 30S subunit [58133] (1 species)
  7. 897618Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 897621Domain d2uxde1: 2uxd E:5-154 [152285]
    Other proteins in same PDB: d2uxdb1, d2uxdd1, d2uxdf1, d2uxdg1, d2uxdh1, d2uxdi1, d2uxdj1, d2uxdk1, d2uxdl1, d2uxdm1, d2uxdn1, d2uxdo1, d2uxdp1, d2uxdq1, d2uxdr1, d2uxds1, d2uxdt1, d2uxdv1
    automatically matched to d1fkae_
    complexed with k, mg, par, zn

Details for d2uxde1

PDB Entry: 2uxd (more details), 3.2 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (E:) ribosomal protein s5

SCOP Domain Sequences for d2uxde1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxde1 i.1.1.3 (E:5-154) 30S subunit {Thermus thermophilus [TaxId: 274]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
srnpiniayatmealrqlrtkadverlrkg

SCOP Domain Coordinates for d2uxde1:

Click to download the PDB-style file with coordinates for d2uxde1.
(The format of our PDB-style files is described here.)

Timeline for d2uxde1: