| Class i: Low resolution protein structures [58117] (26 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
| Protein 70S ribosome functional complex [58121] (9 species) |
| Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries) |
| Domain d2uxds1: 2uxd S:2-81 [152299] Other proteins in same PDB: d2uxdb1, d2uxdd1, d2uxde1, d2uxdf1, d2uxdg1, d2uxdh1, d2uxdi1, d2uxdj1, d2uxdk1, d2uxdm1, d2uxdn1, d2uxdq1, d2uxdr1, d2uxdt1, d2uxdv1 automatically matched to d1ibms_ complexed with k, mg, par, zn |
PDB Entry: 2uxd (more details), 3.2 Å
SCOP Domain Sequences for d2uxds1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxds1 i.1.1.1 (S:2-81) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr
Timeline for d2uxds1: