Lineage for d2ux2a_ (2ux2 A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1062938Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1062939Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1063138Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins)
  6. 1063150Protein CD59 [57355] (1 species)
  7. 1063151Species Human (Homo sapiens) [TaxId:9606] [57356] (6 PDB entries)
  8. 1063152Domain d2ux2a_: 2ux2 A: [152249]
    automated match to d1cdqa_

Details for d2ux2a_

PDB Entry: 2ux2 (more details), 1.8 Å

PDB Description: high resolution structure of human cd59
PDB Compounds: (A:) cd59 glycoprotein

SCOPe Domain Sequences for d2ux2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ux2a_ g.7.1.3 (A:) CD59 {Human (Homo sapiens) [TaxId: 9606]}
mlqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenel
tyycckkdlcnfneqlen

SCOPe Domain Coordinates for d2ux2a_:

Click to download the PDB-style file with coordinates for d2ux2a_.
(The format of our PDB-style files is described here.)

Timeline for d2ux2a_: