SCOPe 2.05: Domain d2rozb1: 2roz B:1-136

Lineage for d2rozb1 (2roz B:1-136)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
   Pfam PF00640

6. Protein Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 [117259] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117260] (2 PDB entries)
   Uniprot Q9DBR4 582-704

8. Domain d2rozb1: 2roz B:1-136 [152178]
   automatically matched to d1wgua_

Details for d2rozb1

PDB Entry: 2roz

PDB Description: structure of the c-terminal pid domain of fe65l1 complexed with the cytoplasmic tail of app reveals a novel peptide binding mode

PDB Compounds: (B:) Amyloid beta A4 precursor protein-binding family B member 2

SCOPe Domain Sequences for d2rozb1:

Sequence; same for both SEQRES and ATOM records:

>d2rozb1 b.55.1.2 (B:1-136) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgptpktelvqkfrvqylgmlpvdrpvgmdtlnsaienlmtssskedwpsvnmnv
adatvtvisekneeevlvecrvrflsfmgvgkdvhtfafimdtgnqrfechvfwcepnaa
nvseavqaacsgpssg

Timeline for d2rozb1:

• d2rozb1 first appeared in SCOP 1.75
  
• d2rozb1 appears in SCOPe 2.04
  
• d2rozb1 appears in SCOPe 2.06
  
• d2rozb1 appears in the current release, SCOPe 2.08