Class b: All beta proteins [48724] (176 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins) Pfam PF00640 |
Protein Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 [117259] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [117260] (2 PDB entries) Uniprot Q9DBR4 582-704 |
Domain d2rozb1: 2roz B:1-136 [152178] automatically matched to d1wgua_ |
PDB Entry: 2roz (more details)
SCOPe Domain Sequences for d2rozb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rozb1 b.55.1.2 (B:1-136) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]} gssgssgptpktelvqkfrvqylgmlpvdrpvgmdtlnsaienlmtssskedwpsvnmnv adatvtvisekneeevlvecrvrflsfmgvgkdvhtfafimdtgnqrfechvfwcepnaa nvseavqaacsgpssg
Timeline for d2rozb1: