SCOPe 2.01: Domain d2ridc1: 2rid C:235-355

Lineage for d2ridc1 (2rid C:235-355)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Surfactant protein, lectin domain [56461] (2 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (14 PDB entries)

8. Domain d2ridc1: 2rid C:235-355 [152081]
   Other proteins in same PDB: d2rida2, d2ridb2, d2ridc2
   automatically matched to d1b08a1
   complexed with 291, ca

Details for d2ridc1

PDB Entry: 2rid, 1.8 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with allyl 7-o- carbamoyl-l-glycero-d-manno-heptopyranoside

PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2ridc1:

Sequence; same for both SEQRES and ATOM records:

>d2ridc1 d.169.1.1 (C:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

Timeline for d2ridc1:

• d2ridc1 first appeared in SCOP 1.75
  
• d2ridc1 appears in SCOPe 2.02
  
• d2ridc1 appears in the current release, SCOPe 2.08