Lineage for d2ricb1 (2ric B:235-355)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2235412Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2235413Protein automated matches [190159] (16 species)
    not a true protein
  7. 2235465Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)
  8. 2235533Domain d2ricb1: 2ric B:235-355 [152073]
    Other proteins in same PDB: d2rica2, d2rica3, d2ricb2, d2ricc2, d2ricc3
    complexed with ca, gmh

Details for d2ricb1

PDB Entry: 2ric (more details), 1.8 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with l-glycero-d- manno-heptopyranosyl-(1-3)-l-glycero-d-manno-heptopyranose
PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2ricb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ricb1 d.169.1.0 (B:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d2ricb1:

Click to download the PDB-style file with coordinates for d2ricb1.
(The format of our PDB-style files is described here.)

Timeline for d2ricb1: