SCOP 1.75: Domain d2reth1: 2ret H:32-196

Lineage for d2reth1 (2ret H:32-196)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (7 families)
   bacterial filament proteins

5. Family d.24.1.5: EpsJ-like [160127] (2 proteins)

6. Protein Type II secretory pathway component EpsJ [160128] (1 species)

7. Species Vibrio vulnificus [TaxId:672] [160129] (1 PDB entry)
   Uniprot Q7MPZ0 48-213

8. Domain d2reth1: 2ret H:32-196 [151990]
   Other proteins in same PDB: d2reta1, d2retc1, d2rete1, d2retg1
   automatically matched to 2RET B:32-197
   complexed with cl, na; mutant

Details for d2reth1

PDB Entry: 2ret, 2.21 Å

PDB Description: the crystal structure of a binary complex of two pseudopilins: epsi and epsj from the type 2 secretion system of vibrio vulnificus

PDB Compounds: (H:) EpsJ

SCOP Domain Sequences for d2reth1:

Sequence, based on SEQRES records:

>d2reth1 d.24.1.5 (H:32-196) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
elsqertarlnelqralvmmdsdfrqialrqtrtngeepskkllhwadylldsdnkgimf
arlgwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvr
fydgkqwinewsneltlpaaisveltlkdygkiartyltpegnlq

Sequence, based on observed residues (ATOM records):

>d2reth1 d.24.1.5 (H:32-196) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
elsqertarlnelqralvmmdsdfrqialrqtrtkkllhwadylldsdnkgimfarlgwh
npqqqfprgevtkvgyrikderlervwwrypdtpqegvvtpllsdveelnvrfydgkqwi
newsneltlpaaisveltlkdygkiartyltpegnlq

Timeline for d2reth1:

• d2reth1 is new in SCOP 1.75
  
• d2reth1 is called d2reth_ in SCOPe 2.01
  
• d2reth1 appears in the current release, SCOPe 2.08, called d2reth_