Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
Superfamily d.24.1: Pili subunits [54523] (7 families) bacterial filament proteins |
Family d.24.1.5: EpsJ-like [160127] (2 proteins) |
Protein Type II secretory pathway component EpsJ [160128] (1 species) |
Species Vibrio vulnificus [TaxId:672] [160129] (1 PDB entry) Uniprot Q7MPZ0 48-213 |
Domain d2retb1: 2ret B:32-197 [151984] Other proteins in same PDB: d2reta1, d2retc1, d2rete1, d2retg1 complexed with cl, na; mutant |
PDB Entry: 2ret (more details), 2.21 Å
SCOP Domain Sequences for d2retb1:
Sequence, based on SEQRES records: (download)
>d2retb1 d.24.1.5 (B:32-197) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]} elsqertarlnelqralvmmdsdfrqialrqtrtngeepskkllhwadylldsdnkgimf arlgwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvr fydgkqwinewsneltlpaaisveltlkdygkiartyltpegnlqk
>d2retb1 d.24.1.5 (B:32-197) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]} elsqertarlnelqralvmmdsdfrqialrqtrtskkllhwadylldsdnkgimfarlgw hnpqqqfprgevtkvgyrikderlervwwrypdtpqegvvtpllsdveelnvrfydgkqw inewsneltlpaaisveltlkdygkiartyltpegnlqk
Timeline for d2retb1: