Lineage for d2retb1 (2ret B:32-197)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857413Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 857414Superfamily d.24.1: Pili subunits [54523] (7 families) (S)
    bacterial filament proteins
  5. 857467Family d.24.1.5: EpsJ-like [160127] (2 proteins)
  6. 857471Protein Type II secretory pathway component EpsJ [160128] (1 species)
  7. 857472Species Vibrio vulnificus [TaxId:672] [160129] (1 PDB entry)
    Uniprot Q7MPZ0 48-213
  8. 857473Domain d2retb1: 2ret B:32-197 [151984]
    Other proteins in same PDB: d2reta1, d2retc1, d2rete1, d2retg1
    complexed with cl, na; mutant

Details for d2retb1

PDB Entry: 2ret (more details), 2.21 Å

PDB Description: the crystal structure of a binary complex of two pseudopilins: epsi and epsj from the type 2 secretion system of vibrio vulnificus
PDB Compounds: (B:) EpsJ

SCOP Domain Sequences for d2retb1:

Sequence, based on SEQRES records: (download)

>d2retb1 d.24.1.5 (B:32-197) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
elsqertarlnelqralvmmdsdfrqialrqtrtngeepskkllhwadylldsdnkgimf
arlgwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvr
fydgkqwinewsneltlpaaisveltlkdygkiartyltpegnlqk

Sequence, based on observed residues (ATOM records): (download)

>d2retb1 d.24.1.5 (B:32-197) Type II secretory pathway component EpsJ {Vibrio vulnificus [TaxId: 672]}
elsqertarlnelqralvmmdsdfrqialrqtrtskkllhwadylldsdnkgimfarlgw
hnpqqqfprgevtkvgyrikderlervwwrypdtpqegvvtpllsdveelnvrfydgkqw
inewsneltlpaaisveltlkdygkiartyltpegnlqk

SCOP Domain Coordinates for d2retb1:

Click to download the PDB-style file with coordinates for d2retb1.
(The format of our PDB-style files is described here.)

Timeline for d2retb1: