Lineage for d2retg1 (2ret G:30-110)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857413Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 857414Superfamily d.24.1: Pili subunits [54523] (7 families) (S)
    bacterial filament proteins
  5. 857481Family d.24.1.7: GSPII I/J protein-like [160135] (2 proteins)
    Pfam PF02501
  6. 857482Protein Pseudopilin EpsI [160136] (1 species)
  7. 857483Species Vibrio vulnificus [TaxId:672] [160137] (1 PDB entry)
    Uniprot Q7MPZ1 63-143
  8. 857487Domain d2retg1: 2ret G:30-110 [151989]
    Other proteins in same PDB: d2retb1, d2retd1, d2retf1, d2reth1
    automatically matched to 2RET A:30-110
    complexed with cl, na; mutant

Details for d2retg1

PDB Entry: 2ret (more details), 2.21 Å

PDB Description: the crystal structure of a binary complex of two pseudopilins: epsi and epsj from the type 2 secretion system of vibrio vulnificus
PDB Compounds: (G:) Pseudopilin EpsI

SCOP Domain Sequences for d2retg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2retg1 d.24.1.7 (G:30-110) Pseudopilin EpsI {Vibrio vulnificus [TaxId: 672]}
tvgyleqkmfaamvadnqmamvmlnpknlkasngeeelagqtwywkvapvattqpllkaf
dvsvaattqaspiitvrsyva

SCOP Domain Coordinates for d2retg1:

Click to download the PDB-style file with coordinates for d2retg1.
(The format of our PDB-style files is described here.)

Timeline for d2retg1: