Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
Superfamily d.24.1: Pili subunits [54523] (7 families) bacterial filament proteins |
Family d.24.1.7: GSPII I/J protein-like [160135] (2 proteins) Pfam PF02501 |
Protein Pseudopilin EpsI [160136] (1 species) |
Species Vibrio vulnificus [TaxId:672] [160137] (1 PDB entry) Uniprot Q7MPZ1 63-143 |
Domain d2retg1: 2ret G:30-110 [151989] Other proteins in same PDB: d2retb1, d2retd1, d2retf1, d2reth1 automatically matched to 2RET A:30-110 complexed with cl, na; mutant |
PDB Entry: 2ret (more details), 2.21 Å
SCOP Domain Sequences for d2retg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2retg1 d.24.1.7 (G:30-110) Pseudopilin EpsI {Vibrio vulnificus [TaxId: 672]} tvgyleqkmfaamvadnqmamvmlnpknlkasngeeelagqtwywkvapvattqpllkaf dvsvaattqaspiitvrsyva
Timeline for d2retg1: