Lineage for d2rbtx_ (2rbt X:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005120Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2005140Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2005141Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (198 PDB entries)
    Uniprot P00431
  8. 2005146Domain d2rbtx_: 2rbt X: [151857]
    automated match to d1ac4a_
    complexed with 271, hem, mpd, po4

Details for d2rbtx_

PDB Entry: 2rbt (more details), 1.24 Å

PDB Description: n-methylbenzylamine in complex with cytochrome c peroxidase w191g
PDB Compounds: (X:) cytochrome c peroxidase

SCOPe Domain Sequences for d2rbtx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rbtx_ a.93.1.1 (X:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn
tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthl
knsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp
kylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d2rbtx_:

Click to download the PDB-style file with coordinates for d2rbtx_.
(The format of our PDB-style files is described here.)

Timeline for d2rbtx_: