Lineage for d2rbpa_ (2rbp A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1014129Family d.2.1.3: Phage lysozyme [53981] (3 proteins)
  6. 1014135Protein Phage T4 lysozyme [53982] (1 species)
  7. 1014136Species Bacteriophage T4 [TaxId:10665] [53983] (520 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 1014163Domain d2rbpa_: 2rbp A: [151853]
    automated match to d1lgua_
    complexed with 266, po4

Details for d2rbpa_

PDB Entry: 2rbp (more details), 1.47 Å

PDB Description: 2-(n-propylthio)ethanol in complex with t4 lysozyme l99a/m102q
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d2rbpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rbpa_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainqvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOPe Domain Coordinates for d2rbpa_:

Click to download the PDB-style file with coordinates for d2rbpa_.
(The format of our PDB-style files is described here.)

Timeline for d2rbpa_: