Lineage for d2r9xb_ (2r9x B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244171Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 2244213Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (101 PDB entries)
  8. 2244293Domain d2r9xb_: 2r9x B: [151809]
    automated match to d1c3ba_
    complexed with dms, po4, wh6

Details for d2r9xb_

PDB Entry: 2r9x (more details), 1.9 Å

PDB Description: ampc beta-lactamase with bound phthalamide inhibitor
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d2r9xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r9xb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOPe Domain Coordinates for d2r9xb_:

Click to download the PDB-style file with coordinates for d2r9xb_.
(The format of our PDB-style files is described here.)

Timeline for d2r9xb_: