Class b: All beta proteins [48724] (174 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) |
Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
Protein Plant cytotoxin B-chain (lectin) [50372] (5 species) duplication: consists of two domains of this fold |
Species European mistletoe (Viscum album) [TaxId:3972] [50375] (14 PDB entries) different sequence variants Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity |
Domain d2r9kb1: 2r9k B:249-384 [151790] Other proteins in same PDB: d2r9ka_ automatically matched to d1m2tb1 complexed with cl, gol, nag, sgi, so4 |
PDB Entry: 2r9k (more details), 2.7 Å
SCOPe Domain Sequences for d2r9kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r9kb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} avtctasepivrivgrngmtvdvrdddfhdgnqiqlwpsksnndpnqlwtikkdgtirsn gsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttltv qtldytlgqgwlagnd
Timeline for d2r9kb1: