SCOPe 2.01: Domain d2r9hd2: 2r9h D:107-210

Lineage for d2r9hd2 (2r9h D:107-210)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)

7. Species Escherichia coli [TaxId:562] [158872] (3 PDB entries)

8. Domain d2r9hd2: 2r9h D:107-210 [151785]
   Other proteins in same PDB: d2r9hd1, d2r9hf1
   automatically matched to d1dqdl2
   complexed with cl; mutant

Details for d2r9hd2

PDB Entry: 2r9h, 3.1 Å

PDB Description: crystal structure of q207c mutant of clc-ec1 in complex with fab

PDB Compounds: (D:) fab fragment

SCOPe Domain Sequences for d2r9hd2:

Sequence; same for both SEQRES and ATOM records:

>d2r9hd2 b.1.1.2 (D:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Escherichia coli [TaxId: 562]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d2r9hd2:

• d2r9hd2 first appeared in SCOP 1.75
  
• d2r9hd2 appears in SCOPe 2.02
  
• d2r9hd2 appears in the current release, SCOPe 2.08