Lineage for d2r92k1 (2r92 K:1-112)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1972825Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 1972826Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 1972827Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 1972828Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 1972829Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 1972838Domain d2r92k1: 2r92 K:1-112 [151752]
    Other proteins in same PDB: d2r92b1, d2r92f1, d2r92h1, d2r92j1, d2r92l1
    automatically matched to d1wcmk_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2r92k1

PDB Entry: 2r92 (more details), 3.8 Å

PDB Description: elongation complex of rna polymerase ii with artificial rdrp scaffold
PDB Compounds: (K:) DNA-directed RNA polymerase II subunit RPB11

SCOPe Domain Sequences for d2r92k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r92k1 i.8.1.1 (K:1-112) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlq

SCOPe Domain Coordinates for d2r92k1:

Click to download the PDB-style file with coordinates for d2r92k1.
(The format of our PDB-style files is described here.)

Timeline for d2r92k1: