SCOPe 2.02: Domain d2r4ic_: 2r4i C:

Lineage for d2r4ic_ (2r4i C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.15: CHU142-like [159988] (1 protein)
   single domain covered by PfamB PB000743 in the N-terminal part and PfamB PB000860 in the C-terminal part

6. Protein Uncharacterized protein CHU142 [159989] (1 species)

7. Species Cytophaga hutchinsonii [TaxId:985] [159990] (1 PDB entry)
   Uniprot Q11V67 1-122

8. Domain d2r4ic_: 2r4i C: [151578]
   automated match to d2r4ia1
   complexed with cit, gol, ipa

Details for d2r4ic_

PDB Entry: 2r4i, 1.6 Å

PDB Description: crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution

PDB Compounds: (C:) Uncharacterized protein

SCOPe Domain Sequences for d2r4ic_:

Sequence; same for both SEQRES and ATOM records:

>d2r4ic_ d.17.4.15 (C:) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]}
nqrdvildcekklltaiqnndveslevllhddllfiipsgetvtketdiaayssgkialr
avvpsdyiiriihdtvvvsvnieikgeymehtldntfrylrvwklfdgnwkviagsctai

Timeline for d2r4ic_:

• d2r4ic_ first appeared in SCOP 1.75, called d2r4ic1
  
• d2r4ic_ appears in SCOPe 2.01
  
• d2r4ic_ appears in SCOPe 2.03
  
• d2r4ic_ appears in the current release, SCOPe 2.08