SCOPe 2.06: Domain d2r17b_: 2r17 B:

Lineage for d2r17b_ (2r17 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.7: YfcE-like [111233] (5 proteins)

6. Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160872] (3 PDB entries)

8. Domain d2r17b_: 2r17 B: [151511]
   automated match to d1w24a1
   complexed with gol

Details for d2r17b_

PDB Entry: 2r17, 2.8 Å

PDB Description: functional architecture of the retromer cargo-recognition complex

PDB Compounds: (B:) Vacuolar protein sorting-associated protein 29

SCOPe Domain Sequences for d2r17b_:

Sequence; same for both SEQRES and ATOM records:

>d2r17b_ d.159.1.7 (B:) Vacuolar protein sorting 29, VPS29 {Human (Homo sapiens) [TaxId: 9606]}
mmlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhiv
rgdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkf
eafehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkveriey
kkp

Timeline for d2r17b_:

• d2r17b_ first appeared in SCOP 1.75, called d2r17b1
  
• d2r17b_ appears in SCOPe 2.05
  
• d2r17b_ appears in SCOPe 2.07
  
• d2r17b_ appears in the current release, SCOPe 2.08