Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.15: EutN/CcmL-like [159133] (1 family) homohexameric unit |
Family b.40.15.1: EutN/CcmL-like [159134] (3 proteins) Pfam PF03319 |
Protein Carbon dioxide concentrating mechanism protein CcmL [159139] (1 species) |
Species Synechocystis sp. PCC 6803 [TaxId:1148] [159140] (1 PDB entry) Uniprot P72759 1-96 |
Domain d2qw7j_: 2qw7 J: [151414] automated match to d2qw7a1 complexed with gol |
PDB Entry: 2qw7 (more details), 2.4 Å
SCOPe Domain Sequences for d2qw7j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qw7j_ b.40.15.1 (J:) Carbon dioxide concentrating mechanism protein CcmL {Synechocystis sp. PCC 6803 [TaxId: 1148]} mqlakvlgtvvstsktpnltgvklllvqfldtkgqpleryevagdvvgaglnewvlvarg saarkergngdrpldamvvgiidtvnvasgslynkr
Timeline for d2qw7j_: