SCOPe 2.07: Domain d2qtvb_: 2qtv B:

Lineage for d2qtvb_ (2qtv B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein SAR1 [69483] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82403] (2 PDB entries)

8. Domain d2qtvb_: 2qtv B: [151362]
   Other proteins in same PDB: d2qtva1, d2qtva2, d2qtva3, d2qtva4, d2qtva5
   automated match to d1m2ob_
   complexed with gnp, mg, zn

Details for d2qtvb_

PDB Entry: 2qtv, 2.5 Å

PDB Description: structure of sec23-sar1 complexed with the active fragment of sec31

PDB Compounds: (B:) Small COPII coat GTPase SAR1

SCOPe Domain Sequences for d2qtvb_:

Sequence, based on SEQRES records:

>d2qtvb_ c.37.1.8 (B:) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hgkllflgldnagkttllhmlkndrlatlqptwhptseelaignikfttfdlgghiqarr
lwkdyfpevngivflvdaadperfdearveldalfniaelkdvpfvilgnkidapnavse
aelrsalgllnttgsqriegqrpvevfmcsvvmrngyleafqwlsqy

Sequence, based on observed residues (ATOM records):

>d2qtvb_ c.37.1.8 (B:) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hgkllflgldnagkttllhmlkndrlatlqptwhptseelaignikfttfdlgghiqarr
lwkdyfpevngivflvdaadperfdearveldalfniaelkdvpfvilgnkidapnavse
aelrsalgllnttgiegqrpvevfmcsvvmrngyleafqwlsqy

Timeline for d2qtvb_:

• d2qtvb_ first appeared in SCOP 1.75, called d2qtvb1
  
• d2qtvb_ appears in SCOPe 2.06
  
• d2qtvb_ appears in the current release, SCOPe 2.08