Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein SAR1 [69483] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82403] (2 PDB entries) |
Domain d2qtvb_: 2qtv B: [151362] Other proteins in same PDB: d2qtva1, d2qtva2, d2qtva3, d2qtva4, d2qtva5 automated match to d1m2ob_ complexed with gnp, mg, zn |
PDB Entry: 2qtv (more details), 2.5 Å
SCOPe Domain Sequences for d2qtvb_:
Sequence, based on SEQRES records: (download)
>d2qtvb_ c.37.1.8 (B:) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} hgkllflgldnagkttllhmlkndrlatlqptwhptseelaignikfttfdlgghiqarr lwkdyfpevngivflvdaadperfdearveldalfniaelkdvpfvilgnkidapnavse aelrsalgllnttgsqriegqrpvevfmcsvvmrngyleafqwlsqy
>d2qtvb_ c.37.1.8 (B:) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} hgkllflgldnagkttllhmlkndrlatlqptwhptseelaignikfttfdlgghiqarr lwkdyfpevngivflvdaadperfdearveldalfniaelkdvpfvilgnkidapnavse aelrsalgllnttgiegqrpvevfmcsvvmrngyleafqwlsqy
Timeline for d2qtvb_: