![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.10: Zn-finger domain of Sec23/24 [82919] (1 family) ![]() |
![]() | Family g.41.10.1: Zn-finger domain of Sec23/24 [82920] (2 proteins) |
![]() | Protein Sec23 [82921] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82922] (3 PDB entries) |
![]() | Domain d2qtva5: 2qtv A:45-119 [151361] Other proteins in same PDB: d2qtva1, d2qtva2, d2qtva3, d2qtva4, d2qtvb_ automatically matched to d1m2oa5 complexed with gnp, mg, zn |
PDB Entry: 2qtv (more details), 2.5 Å
SCOPe Domain Sequences for d2qtva5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qtva5 g.41.10.1 (A:45-119) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} elnvapynpvvcsgphcksilnpycvidprnsswscpicnsrnhlppqytnlsqenmple lqsttieyitnkpvt
Timeline for d2qtva5:
![]() Domains from same chain: (mouse over for more information) d2qtva1, d2qtva2, d2qtva3, d2qtva4 |