Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.13: NIL domain-like [160322] (2 proteins) Pfam PF09383 |
Protein Methionine import ATP-binding protein MetN2 [160326] (2 species) |
Species Enterococcus faecalis [TaxId:1351] [160327] (1 PDB entry) Uniprot Q831K6 256-345 |
Domain d2qswa1: 2qsw A:256-345 [151326] complexed with gol, zn |
PDB Entry: 2qsw (more details), 1.5 Å
SCOPe Domain Sequences for d2qswa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qswa1 d.58.18.13 (A:256-345) Methionine import ATP-binding protein MetN2 {Enterococcus faecalis [TaxId: 1351]} lvveemleqypngkivrllfhgeqaklpiishivqeyqvevsiiqgniqqtkqgavgsly iqllgeeqnilaaieglrklrvetevigne
Timeline for d2qswa1: