Lineage for d2qpuc2 (2qpu C:1-347)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1568603Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1569061Protein Plant alpha-amylase [51474] (2 species)
  7. 1569062Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89465] (7 PDB entries)
  8. 1569066Domain d2qpuc2: 2qpu C:1-347 [151214]
    Other proteins in same PDB: d2qpua1, d2qpub1, d2qpuc1
    automatically matched to d1ht6a2
    complexed with bgc, ca, edo, qps, qpu; mutant

Details for d2qpuc2

PDB Entry: 2qpu (more details), 1.7 Å

PDB Description: sugar tongs mutant s378p in complex with acarbose
PDB Compounds: (C:) Alpha-amylase type A isozyme

SCOPe Domain Sequences for d2qpuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qpuc2 c.1.8.1 (C:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]}
hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrng

SCOPe Domain Coordinates for d2qpuc2:

Click to download the PDB-style file with coordinates for d2qpuc2.
(The format of our PDB-style files is described here.)

Timeline for d2qpuc2: