Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Plant alpha-amylase [51474] (2 species) |
Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89465] (8 PDB entries) |
Domain d2qpuc2: 2qpu C:1-347 [151214] Other proteins in same PDB: d2qpua1, d2qpub1, d2qpuc1 automatically matched to d1ht6a2 complexed with bgc, ca, edo, qps, qpu; mutant |
PDB Entry: 2qpu (more details), 1.7 Å
SCOPe Domain Sequences for d2qpuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpuc2 c.1.8.1 (C:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrng
Timeline for d2qpuc2:
View in 3D Domains from other chains: (mouse over for more information) d2qpua1, d2qpua2, d2qpub1, d2qpub2 |