Lineage for d2qpuc1 (2qpu C:348-404)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2076870Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2077257Protein Plant alpha-amylase [51040] (2 species)
    single beta-sheet; probable result of a decay of the common-fold
  7. 2077258Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89384] (7 PDB entries)
  8. 2077262Domain d2qpuc1: 2qpu C:348-404 [151213]
    Other proteins in same PDB: d2qpua2, d2qpub2, d2qpuc2
    automatically matched to d1ht6a1
    complexed with bgc, ca, edo, qps, qpu; mutant

Details for d2qpuc1

PDB Entry: 2qpu (more details), 1.7 Å

PDB Description: sugar tongs mutant s378p in complex with acarbose
PDB Compounds: (C:) Alpha-amylase type A isozyme

SCOPe Domain Sequences for d2qpuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qpuc1 b.71.1.1 (C:348-404) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]}
itatsalkilmhegdayvaeidgkvvvkigprydvgavipagfvtsahgndyavwek

SCOPe Domain Coordinates for d2qpuc1:

Click to download the PDB-style file with coordinates for d2qpuc1.
(The format of our PDB-style files is described here.)

Timeline for d2qpuc1: