SCOPe 2.08: Domain d2qowe1: 2qow E:78-158

Lineage for d2qowe1 (2qow E:78-158)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (5 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Escherichia coli [TaxId:562] [159906] (24 PDB entries)
   Uniprot P0A7W1 78-158

8. Domain d2qowe1: 2qow E:78-158 [151041]
   Other proteins in same PDB: d2qowb1, d2qowc1, d2qowc2, d2qowd1, d2qowe2, d2qowf1, d2qowg1, d2qowh1, d2qowi1, d2qowj1, d2qowk1, d2qowl1, d2qowm1, d2qown1, d2qowp1, d2qowq1, d2qowr1, d2qows1, d2qowt1, d2qowu1
   protein/RNA complex; complexed with mg, scm
   protein/RNA complex; complexed with mg, scm

Details for d2qowe1

PDB Entry: 2qow, 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2qowe1:

Sequence; same for both SEQRES and ATOM records:

>d2qowe1 d.14.1.1 (E:78-158) Ribosomal protein S5, C-terminal domain {Escherichia coli [TaxId: 562]}
gtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakaygstnpinvvr
atidglenmnspemvaakrgk

Timeline for d2qowe1:

• d2qowe1 first appeared in SCOP 1.75
  
• d2qowe1 appears in SCOPe 2.07