Lineage for d2qexr1 (2qex R:1-150)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203503Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 1203504Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 1203505Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 1203506Protein Ribosomal protein L22 [54845] (5 species)
  7. 1203544Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
    Uniprot P10970
  8. 1203583Domain d2qexr1: 2qex R:1-150 [150706]
    Other proteins in same PDB: d2qex11, d2qex21, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1, d2qexz1
    automatically matched to d1ffko_
    complexed with cd, cl, k, mg, na, neg

Details for d2qexr1

PDB Entry: 2qex (more details), 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
PDB Compounds: (R:) 50S ribosomal protein L22P

SCOPe Domain Sequences for d2qexr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qexr1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOPe Domain Coordinates for d2qexr1:

Click to download the PDB-style file with coordinates for d2qexr1.
(The format of our PDB-style files is described here.)

Timeline for d2qexr1: