Class b: All beta proteins [48724] (174 folds) |
Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
Superfamily b.155.1: L21p-like [141091] (1 family) |
Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
Protein Ribosomal protein L21p [141093] (3 species) |
Species Escherichia coli [TaxId:562] [141094] (27 PDB entries) Uniprot P0AG48 1-103 |
Domain d2qbir1: 2qbi R:1-103 [150586] Other proteins in same PDB: d2qbi01, d2qbi11, d2qbi31, d2qbi41, d2qbi61, d2qbic1, d2qbic2, d2qbid1, d2qbie1, d2qbif1, d2qbig1, d2qbig2, d2qbih1, d2qbih2, d2qbii1, d2qbii2, d2qbij1, d2qbik1, d2qbil1, d2qbim1, d2qbin1, d2qbio1, d2qbip1, d2qbiq1, d2qbis1, d2qbit1, d2qbiu1, d2qbiv1, d2qbiw1, d2qbix1, d2qbiy1, d2qbiz1 automatically matched to d1vs6r1 protein/RNA complex; complexed with lll, mg, zn |
PDB Entry: 2qbi (more details), 4 Å
SCOPe Domain Sequences for d2qbir1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbir1 b.155.1.1 (R:1-103) Ribosomal protein L21p {Escherichia coli [TaxId: 562]} myavfqsggkqhrvsegqtvrlekldiatgetvefaevlmiangeevkigvpfvdggvik aevvahgrgekvkivkfrrrkhyrkqqghrqwftdvkitgisa
Timeline for d2qbir1:
View in 3D Domains from other chains: (mouse over for more information) d2qbi01, d2qbi11, d2qbi31, d2qbi41, d2qbi61, d2qbic1, d2qbic2, d2qbid1, d2qbie1, d2qbif1, d2qbig1, d2qbig2, d2qbih1, d2qbih2, d2qbii1, d2qbii2, d2qbij1, d2qbik1, d2qbil1, d2qbim1, d2qbin1, d2qbio1, d2qbip1, d2qbiq1, d2qbis1, d2qbit1, d2qbiu1, d2qbiv1, d2qbiw1, d2qbix1, d2qbiy1, d2qbiz1 |