SCOPe 2.05: Domain d2q85a1: 2q85 A:2-200

Lineage for d2q85a1 (2q85 A:2-200)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.2: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain [56184] (1 protein)

6. Protein Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain [56185] (2 species)

7. Species Escherichia coli [TaxId:562] [56186] (5 PDB entries)

8. Domain d2q85a1: 2q85 A:2-200 [150118]
   Other proteins in same PDB: d2q85a2
   automated match to d1mbba1
   complexed with 973, fad

Details for d2q85a1

PDB Entry: 2q85, 2.51 Å

PDB Description: Crystal Structure of E. Coli Mur B bound to a Naphthyl Tetronic Acid inihibitor

PDB Compounds: (A:) udp-n-acetylenolpyruvoylglucosamine reductase

SCOPe Domain Sequences for d2q85a1:

Sequence; same for both SEQRES and ATOM records:

>d2q85a1 d.145.1.2 (A:2-200) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Escherichia coli [TaxId: 562]}
nhslkpwntfgidhnaqhivcaedeqqllnawqyataegqpvlilgegsnvlfledyrgt
viinrikgieihdepdawylhvgagenwhrlvkytlqegmpglenlalipgcvgsspiqn
igaygvelqrvcayvdsvelatgkqvrltakecrfgyrdsifkheyqdrfaivavglrlp
kewqpvltygdltrldptt

Timeline for d2q85a1:

• d2q85a1 first appeared in SCOP 1.75
  
• d2q85a1 appears in SCOPe 2.04
  
• d2q85a1 appears in SCOPe 2.06
  
• d2q85a1 appears in the current release, SCOPe 2.08