Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries) |
Domain d2q7ya2: 2q7y A:7-185 [150107] Other proteins in same PDB: d2q7ya1, d2q7yb_, d2q7yc1, d2q7yd_ automated match to d1onqa2 complexed with igc, nag, plm |
PDB Entry: 2q7y (more details), 1.95 Å
SCOPe Domain Sequences for d2q7ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q7ya2 d.19.1.1 (A:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]} nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d2q7ya2:
View in 3D Domains from other chains: (mouse over for more information) d2q7yb_, d2q7yc1, d2q7yc2, d2q7yd_ |