Lineage for d2q78d_ (2q78 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944279Family d.38.1.7: TTHA0967-like [143187] (2 proteins)
    contains extra C-terminal helix
  6. 2944286Protein Uncharacterized protein TM0581 [160186] (1 species)
  7. 2944287Species Thermotoga maritima [TaxId:2336] [160187] (1 PDB entry)
    Uniprot Q9WZ50 1-130
  8. 2944291Domain d2q78d_: 2q78 D: [150079]
    Other proteins in same PDB: d2q78a2, d2q78b3, d2q78c3, d2q78e3, d2q78f3, d2q78g3, d2q78h3
    automated match to d2q78a1
    complexed with cl, mlc

Details for d2q78d_

PDB Entry: 2q78 (more details), 2.2 Å

PDB Description: crystal structure of a thioesterase-like protein (tm0581) from thermotoga maritima msb8 at 2.20 a resolution
PDB Compounds: (D:) Uncharacterized protein

SCOPe Domain Sequences for d2q78d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q78d_ d.38.1.7 (D:) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]}
mmdfdflegkrltedvaldetmvwnediemldlhlvatsaligvvhrvsyellsrylpnd
ytavvvetlarhvkavptgtrvavgvrvvgvvgnrvkfrgivmsgdekileaefvraivp
reklrrlale

SCOPe Domain Coordinates for d2q78d_:

Click to download the PDB-style file with coordinates for d2q78d_.
(The format of our PDB-style files is described here.)

Timeline for d2q78d_: