Lineage for d2q66a3 (2q66 A:352-529)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196795Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) (S)
  5. 2196796Family d.58.16.1: Poly(A) polymerase, PAP, C-terminal domain [55004] (1 protein)
    automatically mapped to Pfam PF04926
  6. 2196797Protein Poly(A) polymerase, PAP, C-terminal domain [55005] (2 species)
  7. 2196798Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55006] (5 PDB entries)
  8. 2196799Domain d2q66a3: 2q66 A:352-529 [150059]
    Other proteins in same PDB: d2q66a1, d2q66a2
    automatically matched to d1fa0b1
    protein/RNA complex; complexed with atp, edo, mg

Details for d2q66a3

PDB Entry: 2q66 (more details), 1.8 Å

PDB Description: structure of yeast poly(a) polymerase with atp and oligo(a)
PDB Compounds: (A:) poly(a) polymerase

SCOPe Domain Sequences for d2q66a3:

Sequence, based on SEQRES records: (download)

>d2q66a3 d.58.16.1 (A:352-529) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfn
ienkkekvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrp

Sequence, based on observed residues (ATOM records): (download)

>d2q66a3 d.58.16.1 (A:352-529) Poly(A) polymerase, PAP, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ndfffrykfyleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfes
syccpteddyemiqdkygshktetalnalklvtdeneeesikdapkaylstmyigldfni
kvdihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrp

SCOPe Domain Coordinates for d2q66a3:

Click to download the PDB-style file with coordinates for d2q66a3.
(The format of our PDB-style files is described here.)

Timeline for d2q66a3: