Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin I [46464] (2 species) |
Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (35 PDB entries) |
Domain d6hbia_: 6hbi A: [15000] complexed with hem; mutant |
PDB Entry: 6hbi (more details), 1.8 Å
SCOPe Domain Sequences for d6hbia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hbia_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm andklrghsivlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv lasknfgdkyanawaklvavvqaal
Timeline for d6hbia_: