Lineage for d3sdhb_ (3sdh B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 901969Protein Hemoglobin I [46464] (2 species)
  7. 901970Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (35 PDB entries)
  8. 901976Domain d3sdhb_: 3sdh B: [14985]
    complexed with cmo, hem

Details for d3sdhb_

PDB Entry: 3sdh (more details), 1.4 Å

PDB Description: high resolution crystallographic analysis of a cooperative dimeric hemoglobin
PDB Compounds: (B:) hemoglobin I (carbonmonoxy)

SCOPe Domain Sequences for d3sdhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdhb_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d3sdhb_:

Click to download the PDB-style file with coordinates for d3sdhb_.
(The format of our PDB-style files is described here.)

Timeline for d3sdhb_: