Lineage for d2ptza2 (2ptz A:0-138)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025940Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1025941Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 1025942Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1025985Protein Enolase [54828] (8 species)
  7. 1026041Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [160264] (6 PDB entries)
  8. 1026042Domain d2ptza2: 2ptz A:0-138 [149845]
    Other proteins in same PDB: d2ptza1
    automatically matched to d1oepa2
    complexed with edo, pah, zn

Details for d2ptza2

PDB Entry: 2ptz (more details), 1.65 Å

PDB Description: crystal structure of the t. brucei enolase complexed with phosphonoacetohydroxamate (pah), his156-out conformation
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d2ptza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ptza2 d.54.1.1 (A:0-138) Enolase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
hmtiqkvhgrevldsrgnptvevevttekgvfrsavpsgastgvyeacelrdgdkkryvg
kgclqavknvnevigpaligrdelkqeeldtlmlrldgtpnkgklganailgcsmaiska
aaaakgvplyrylaslagt

SCOPe Domain Coordinates for d2ptza2:

Click to download the PDB-style file with coordinates for d2ptza2.
(The format of our PDB-style files is described here.)

Timeline for d2ptza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ptza1