Lineage for d2ptya1 (2pty A:139-429)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836769Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 2836770Protein Enolase [51606] (11 species)
    Fold of this protein slightly differs from common fold in topology
  7. 2836873Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [159415] (6 PDB entries)
  8. 2836878Domain d2ptya1: 2pty A:139-429 [149842]
    Other proteins in same PDB: d2ptya2, d2ptya3
    automated match to d1oepa1
    complexed with edo, pep, zn

Details for d2ptya1

PDB Entry: 2pty (more details), 2 Å

PDB Description: crystal structure of the t. brucei enolase complexed with pep
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d2ptya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ptya1 c.1.11.1 (A:139-429) Enolase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kelrlpvpcfnvinggkhagnalpfqefmiapvkatsfsealrmgsevyhslrgiikkky
gqdavnvgdeggfappikdineplpilmeaieeaghrgkfaicmdcaasetydekkqqyn
ltfkspeptwvtaeqlretyckwahdypivsiedpydqddfagfagitealkgktqivgd
dltvtnterikmaiekkacnslllkinqigtiseaiassklcmengwsvmvshrsgeted
tyiadlvvalgsgqiktgapcrgertaklnqllrieeelgahakfgfpgws

SCOPe Domain Coordinates for d2ptya1:

Click to download the PDB-style file with coordinates for d2ptya1.
(The format of our PDB-style files is described here.)

Timeline for d2ptya1: