Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (10 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.2: STAR domain [55966] (4 proteins) |
Protein Star-related lipid transfer protein 13 [160730] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [160731] (1 PDB entry) Uniprot Q9Y3M8 908-1104 |
Domain d2psoa1: 2pso A:908-1104 [149824] |
PDB Entry: 2pso (more details), 2.8 Å
SCOP Domain Sequences for d2psoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} tylnhliqglqkeakekfkgwvtcsstdntdlafkkvgdgnplklwkasveveappsvvl nrvlrerhlwdedfvqwkvvetldrqteiyqyvlnsmaphpsrdfvvlrtwktdlpkgmc tlvslsveheeaqllggvravvmdsqyliepcgsgksrlthicridlkghspewyskgfg hlcaaevarirnsfqpl
Timeline for d2psoa1: