Lineage for d2psoa1 (2pso A:908-1104)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040549Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1040601Family d.129.3.2: STAR domain [55966] (4 proteins)
  6. 1040616Protein Star-related lipid transfer protein 13 [160730] (1 species)
  7. 1040617Species Human (Homo sapiens) [TaxId:9606] [160731] (1 PDB entry)
    Uniprot Q9Y3M8 908-1104
  8. 1040618Domain d2psoa1: 2pso A:908-1104 [149824]

Details for d2psoa1

PDB Entry: 2pso (more details), 2.8 Å

PDB Description: human stard13 (dlc2) lipid transfer and protein localization domain
PDB Compounds: (A:) StAR-related lipid transfer protein 13

SCOPe Domain Sequences for d2psoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]}
tylnhliqglqkeakekfkgwvtcsstdntdlafkkvgdgnplklwkasveveappsvvl
nrvlrerhlwdedfvqwkvvetldrqteiyqyvlnsmaphpsrdfvvlrtwktdlpkgmc
tlvslsveheeaqllggvravvmdsqyliepcgsgksrlthicridlkghspewyskgfg
hlcaaevarirnsfqpl

SCOPe Domain Coordinates for d2psoa1:

Click to download the PDB-style file with coordinates for d2psoa1.
(The format of our PDB-style files is described here.)

Timeline for d2psoa1: