Lineage for d2psoc1 (2pso C:909-1102)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872733Superfamily d.129.3: Bet v1-like [55961] (10 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 872774Family d.129.3.2: STAR domain [55966] (4 proteins)
  6. 872789Protein Star-related lipid transfer protein 13 [160730] (1 species)
  7. 872790Species Human (Homo sapiens) [TaxId:9606] [160731] (1 PDB entry)
    Uniprot Q9Y3M8 908-1104
  8. 872793Domain d2psoc1: 2pso C:909-1102 [149826]
    automatically matched to 2PSO A:908-1104

Details for d2psoc1

PDB Entry: 2pso (more details), 2.8 Å

PDB Description: human stard13 (dlc2) lipid transfer and protein localization domain
PDB Compounds: (C:) StAR-related lipid transfer protein 13

SCOP Domain Sequences for d2psoc1:

Sequence, based on SEQRES records: (download)

>d2psoc1 d.129.3.2 (C:909-1102) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]}
ylnhliqglqkeakekfkgwvtcsstdntdlafkkvgdgnplklwkasveveappsvvln
rvlrerhlwdedfvqwkvvetldrqteiyqyvlnsmaphpsrdfvvlrtwktdlpkgmct
lvslsveheeaqllggvravvmdsqyliepcgsgksrlthicridlkghspewyskgfgh
lcaaevarirnsfq

Sequence, based on observed residues (ATOM records): (download)

>d2psoc1 d.129.3.2 (C:909-1102) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]}
ylnhliqglqkeakekfkgwvtcsstdntdlafkkvgdgnplklwkasveveappsvvln
rvlrerhlwdedfvqwkvvetldrqteiyqyvlnsmaphpsrdfvvlrtwktdlpkgmct
lvslsveheeaqllggvravvmdsqyliesrlthicridlkghspewyskgfghlcaaev
arirnsfq

SCOP Domain Coordinates for d2psoc1:

Click to download the PDB-style file with coordinates for d2psoc1.
(The format of our PDB-style files is described here.)

Timeline for d2psoc1: