Lineage for d2pi2g1 (2pi2 G:3-117)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124702Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 1124764Protein Replication protein A 14 KDa (RPA14) subunit [50271] (1 species)
  7. 1124765Species Human (Homo sapiens) [TaxId:9606] [50272] (5 PDB entries)
  8. 1124768Domain d2pi2g1: 2pi2 G:3-117 [149499]
    Other proteins in same PDB: d2pi2a1, d2pi2b1, d2pi2c1, d2pi2d1
    automatically matched to d1l1oa_
    complexed with dio

Details for d2pi2g1

PDB Entry: 2pi2 (more details), 2 Å

PDB Description: Full-length Replication protein A subunits RPA14 and RPA32
PDB Compounds: (G:) Replication protein A 14 kDa subunit

SCOPe Domain Sequences for d2pi2g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pi2g1 b.40.4.3 (G:3-117) Replication protein A 14 KDa (RPA14) subunit {Human (Homo sapiens) [TaxId: 9606]}
dmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepldee
isgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgi

SCOPe Domain Coordinates for d2pi2g1:

Click to download the PDB-style file with coordinates for d2pi2g1.
(The format of our PDB-style files is described here.)

Timeline for d2pi2g1: