SCOPe 2.02: Domain d2pf5a_: 2pf5 A:

Lineage for d2pf5a_ (2pf5 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.4: Link domain [56477] (3 proteins)

6. Protein TSG-6, Link module [56478] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56479] (3 PDB entries)

8. Domain d2pf5a_: 2pf5 A: [149447]
   automated match to d1o7bt_
   complexed with 2pe, so4

Details for d2pf5a_

PDB Entry: 2pf5, 1.9 Å

PDB Description: Crystal Structure of the Human TSG-6 Link Module

PDB Compounds: (A:) tumor necrosis factor-inducible protein tsg-6

SCOPe Domain Sequences for d2pf5a_:

Sequence, based on SEQRES records:

>d2pf5a_ d.169.1.4 (A:) TSG-6, Link module {Human (Homo sapiens) [TaxId: 9606]}
gvyhrearsgkykltyaeakavcefegghlatykqleaarkigfhvcaagwmakgrvgyp
ivkpgpncgfgktgiidygirlnrserwdaycynp

Sequence, based on observed residues (ATOM records):

>d2pf5a_ d.169.1.4 (A:) TSG-6, Link module {Human (Homo sapiens) [TaxId: 9606]}
gvyhrearsgkykltyaeakavcefegghlatykqleaarkigfhvcaagwmakgrvgyp
ivkpktgiidygirlnrserwdaycynp

Timeline for d2pf5a_:

• d2pf5a_ first appeared in SCOP 1.75, called d2pf5a1
  
• d2pf5a_ appears in SCOPe 2.01
  
• d2pf5a_ appears in SCOPe 2.03
  
• d2pf5a_ appears in the current release, SCOPe 2.08