Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (4 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
Protein Hypothetical protein SO1960 [160498] (1 species) |
Species Shewanella oneidensis [TaxId:70863] [160499] (1 PDB entry) Uniprot Q8EFL1 2-153 |
Domain d2otmc_: 2otm C: [149014] automated match to d2otma1 complexed with act, ca, gol, na |
PDB Entry: 2otm (more details), 1.85 Å
SCOPe Domain Sequences for d2otmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otmc_ d.79.1.1 (C:) Hypothetical protein SO1960 {Shewanella oneidensis [TaxId: 70863]} ntpesrlvaaglelpevaaalgnyepysivgsqlmtsgqfpylqgkllyqgqlgadytvs egyaacrlatlnaiaqlkqacgelsrikqiyrlegvlnvhqsciehpkaldgasdlllei fgeagrhsrmiwtnpvmplnslclvylfael
Timeline for d2otmc_: