SCOPe 2.02: Domain d2olea1: 2ole A:39-508

Lineage for d2olea1 (2ole A:39-508)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (2 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82174] (49 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d2olea1: 2ole A:39-508 [148815]
   Other proteins in same PDB: d2olea2, d2oleb2
   automatically matched to d1orva1
   complexed with kr2

Details for d2olea1

PDB Entry: 2ole, 2.4 Å

PDB Description: Crystal Structure Of Human Dipeptidyl Peptidase IV (DPPIV) Complex With Cyclic Hydrazine Derivatives

PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2olea1:

Sequence; same for both SEQRES and ATOM records:

>d2olea1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d2olea1:

• d2olea1 first appeared in SCOP 1.75
  
• d2olea1 appears in SCOPe 2.01
  
• d2olea1 appears in SCOPe 2.03
  
• d2olea1 appears in the current release, SCOPe 2.08