SCOPe 2.08: Domain d2obpb_: 2obp B:

Lineage for d2obpb_ (2obp B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.71: ReutB4095-like [158299] (1 protein)
   probable biological unit is a homohexamer

6. Protein Putative DNA-binding protein ReutB4095 [158300] (1 species)

7. Species Ralstonia eutropha [TaxId:106590] [158301] (1 PDB entry)
   Uniprot Q46TT3 12-92

8. Domain d2obpb_: 2obp B: [148719]
   automated match to d2obpa1
   complexed with cl, no3

Details for d2obpb_

PDB Entry: 2obp, 1.7 Å

PDB Description: crystal structure of a putative dna-binding protein (reut_b4095) from ralstonia eutropha jmp134 at 1.70 a resolution

PDB Compounds: (B:) Putative DNA-binding protein

SCOPe Domain Sequences for d2obpb_:

Sequence; same for both SEQRES and ATOM records:

>d2obpb_ a.4.5.71 (B:) Putative DNA-binding protein ReutB4095 {Ralstonia eutropha [TaxId: 106590]}
gidpaivevllvlreagiengatpwslpkiakraqlpmsvlrrvltqlqaagladvsvea
dgrghasltqegaalaaqlfp

Timeline for d2obpb_:

• d2obpb_ first appeared in SCOP 1.75, called d2obpb1
  
• d2obpb_ appears in SCOPe 2.07